A12677
BRD4 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A12677
- Zusätzliche Namen:
- BRD4|CAP|FSHRG4|HUNK1|HUNKI|MCAP
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 120kDa/140kDa/200kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTT
- Uniprot:
- O60885
- Synonyme:
- bromodomain-containing protein 4;CAP;chromosome-associated protein;HUNK1;HUNKI;MCAP;mitotic chromosome-associated protein;Protein HUNK1
- Weitere Details:
- The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.
- Versandbedingungen:
- Blue Ice



