A12653
WWOX Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12653
- Zusätzliche Namen:
- D16S432E|DEE28|EIEE28|FOR|FRA16D|HHCMA56|PRO0128|SCAR12|SDR41C1|WOX1|WWOX
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 46kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR
- Uniprot:
- Q9NZC7
- Synonyme:
- D16S432E;DEE28;EIEE28;FOR;FRA16D;fragile site FRA16D oxidoreductase;HHCMA56;PRO0128;SCAR12;SDR41C1;short chain dehydrogenase/reductase family 41C member 1;WOX1;WW domain-containing oxidoreductase;WW domain-containing protein WWOX
- Weitere Details:
- This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) protein family. This gene spans the FRA16D common chromosomal fragile site and appears to function as a tumor suppressor gene. Expression of the encoded protein is able to induce apoptosis, while defects in this gene are associated with multiple types of cancer. Disruption of this gene is also associated with autosomal recessive spinocerebellar ataxia 12. Disruption of a similar gene in mouse results in impaired steroidogenesis, additionally suggesting a metabolic function for the protein. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

