A12621
Occludin Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12621
- Zusätzliche Namen:
- BLCPMG|Occludin|PPP1R115|PTORCH1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 62kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL
- Uniprot:
- Q16625
- Synonyme:
- BLCPMG;occludin;phosphatase 1, regulatory subunit 115;PPP1R115;PTORCH1
- Weitere Details:
- This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5.
- Versandbedingungen:
- Blue Ice

_WB_01.jpg)