A12583
KCNK9 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12583
- Zusätzliche Namen:
- BIBARS|K2p9.1|KCNK9|KT3.2|TASK-3|TASK3|TASK32
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
- Uniprot:
- Q9NPC2
- Synonyme:
- acid-sensitive potassium channel protein TASK-3;BIBARS;K2p9.1;KT3.2;potassium 2-pore domain leak channel TASK3;potassium channel subfamily K member 9;potassium channel, two pore domain subfamily K, member 9;TASK-3;TASK3;TASK32;TWIK-related acid-sensitive K(+) channel 3;TWIK-related acid-sensitive K+ 3;two pore K(+) channel KT3.2;two pore potassium channel KT3.2
- Weitere Details:
- This gene encodes a protein that contains multiple transmembrane regions and two pore-forming P domains and functions as a pH-dependent potassium channel. Amplification and overexpression of this gene have been observed in several types of human carcinomas. This gene is imprinted in the brain, with preferential expression from the maternal allele. A mutation in this gene was associated with Birk-Barel dysmorphism syndrome. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

