TRPM8 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12572
Zusätzliche Namen:: LTrpC-6|LTRPC6|trp-p8|TRPM8|TRPP8
Anwendung:: ELISA, WB
Molekulargewicht:: 122kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
Uniprot:: Q7Z2W7
Synonyme:: Long transient receptor potential channel 6;LTrpC-6;LTRPC6;transient receptor potential cation channel subfamily M member 8;transient receptor potential p8;transient receptor potential subfamily M member 8;trp-p8;TRPM8 cationic channel;TRPP8
Weitere Details:: Predicted to enable ligand-gated calcium channel activity. Predicted to be involved in calcium ion transmembrane transport and positive regulation of cold-induced thermogenesis. Predicted to act upstream of or within several processes, including cellular calcium ion homeostasis; response to cold; and thermoception. Located in plasma membrane.