[KO Validated] ABCF2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A12555
Zusätzliche Namen:: ABC28|EST133090|F2|HUSSY-18|HUSSY18
Anwendung:: ELISA, WB
Molekulargewicht:: 71kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFML
Uniprot:: Q9UG63
Synonyme:: ABC-type transport protein;ABC28;ATP-binding cassette sub-family F member 2;ATP-binding cassette, sub-family F (GCN20), member 2;EST133090;HUSSY-18;HUSSY18;iron-inhibited ABC transporter 2
Weitere Details:: This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ATP-binding cassette proteins transport various molecules across extra- and intracellular membranes. Alterations in this gene may be involved in cancer progression. Related pseudogenes have been identified on chromosomes 3 and 7.