A12553
FCGR2B Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12553
- Zusätzliche Namen:
- CD32|CD32B|FCG2|FcgammaRIIb|FCGR2|FCGR2B|FCGR2C|FcGRIIB|FcRII-c|IGFR2
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 40 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
- Uniprot:
- P31994
- Synonyme:
- CD32;CD32B;CDw32;Fc fragment of IgG, low affinity II, receptor for (CD32);Fc fragment of IgG, low affinity IIb, receptor (CD32);Fc fragment of IgG, low affinity IIb, receptor for (CD32);Fc gamma receptor IIb;Fc gamma RIIb;fc-gamma RII-b;Fc-gamma RII-c;fc-gamma-RIIb;Fc-gamma-RIIc;FCG2;FCGR2;FCGR2C;fcRII-b;FcRII-c;IGFR2;igG Fc receptor II-b;IgG Fc receptor II-c;low affinity immunoglobulin gamma Fc region receptor II-b;Low affinity immunoglobulin gamma Fc region receptor II-c
- Weitere Details:
- The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice



