A12539
GBF1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12539
- Zusätzliche Namen:
- ARF1GEF|CMT2GG|CMTDI2|CMTDIA|GBF1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 260kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLA
- Uniprot:
- Q92538
- Synonyme:
- ARF1GEF;BFA-resistant GEF 1;Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
- Weitere Details:
- This gene encodes a member of the Sec7 domain family. The encoded protein is a guanine nucleotide exchange factor that regulates the recruitment of proteins to membranes by mediating GDP to GTP exchange. The encoded protein is localized to the Golgi apparatus and plays a role in vesicular trafficking by activating ADP ribosylation factor 1. The encoded protein has also been identified as an important host factor for viral replication. Multiple transcript variants have been observed for this gene.
- Versandbedingungen:
- Blue Ice

