TIA1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12523
Zusätzliche Namen:: ALS26|TIA-1|TIA1|WDM
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 44kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Uniprot:: P31483
Synonyme:: ALS26;nucleolysin TIA-1;nucleolysin TIA-1 isoform p40;p40-TIA-1;p40-TIA-1 (containing p15-TIA-1);RNA-binding protein TIA-1;T-cell-restricted intracellular antigen-1;TIA-1;WDM
Weitere Details:: The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms has been found for this gene.