A12515
TCEB1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12515
- Zusätzliche Namen:
- SIII|TCEB1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
- Uniprot:
- Q15369
- Synonyme:
- elongin 15 kDa subunit;elongin-C;RNA polymerase II transcription factor SIII subunit C;SIII;SIII p15;TCEB1;transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C);transcription elongation factor B polypeptide 1;transcription elongation factor B subunit 1
- Weitere Details:
- This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.
- Versandbedingungen:
- Blue Ice