SLC1A4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12507
Zusätzliche Namen:: ASCT1|SATT|SLC1A4|SPATCCM
Anwendung:: ELISA, WB
Molekulargewicht:: 56kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEG
Uniprot:: P43007
Synonyme:: alanine/serine/cysteine/threonine transporter 1;ASCT1;glutamate/neutral amino acid transporter;neutral amino acid transporter A;SATT;solute carrier family 1 (glutamate/neutral amino acid transporter), member 4;Solute carrier family 1 member 4;SPATCCM
Weitere Details:: The protein encoded by this gene is a sodium-dependent neutral amino acid transporter for alanine, serine, cysteine, and threonine. Defects in this gene have been associated with developmental delay, microcephaly, and intellectual disability.