Alpha-1 Antitrypsin (SERPINA1) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12481
Zusätzliche Namen:: A1A|A1AT|AAT|Alpha-1 Antitrypsin (SERPINA1)|alpha1AT|nNIF|PI|PI1|PRO2275
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 45kDa,50kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKL
Uniprot:: P01009
Synonyme:: A1A;A1AT;AAT;alpha-1 antitrypsin;alpha-1 protease inhibitor;alpha-1 proteinase inhibitor;alpha-1-antiproteinase;alpha-1-antitrypsin;alpha-1-antitrypsin short transcript variant 1C4;alpha-1-antitrypsin short transcript variant 1C5;alpha1AT;anti-elastase;epididymis secretory sperm binding protein;nNIF;PI;PI1;PRO2275;protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin;serine (or cysteine) proteinase inhibitor, clade A, member 1;serpin A1;serpin peptidase inhibitor clade A (alpha-1antiproteinase, antitrypsin) member 1;serpin peptidase inhibitor clade A member 1;serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Weitere Details:: The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene.

Versandbedingungen:: Blue Ice