MSRA Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12464
Zusätzliche Namen:: MSRA|PMSR
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Uniprot:: Q9UJ68
Synonyme:: cytosolic methionine-S-sulfoxide reductase;mitochondrial peptide methionine sulfoxide reductase;peptide met (O) reductase;peptide Met(O) reductase;peptide-methionine (S)-S-oxide reductase;PMSR;Protein-methionine-S-oxide reductase
Weitere Details:: This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants.