IGFBP5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12451
Zusätzliche Namen:: IBP5|IGFBP5
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 33kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVG
Uniprot:: P24593
Synonyme:: IBP-5;IBP5;IGF-binding protein 5;IGFBP-5;insulin-like growth factor-binding protein 5
Weitere Details:: Enables insulin-like growth factor I binding activity. Involved in several processes, including cellular response to cAMP; regulation of smooth muscle cell migration; and regulation of smooth muscle cell proliferation. Part of insulin-like growth factor ternary complex. Biomarker of pulmonary fibrosis.