A12437
FLT3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12437
- Zusätzliche Namen:
- CD135|FLK-2|FLK2|FLT3|STK1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 130kDa/160kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGME
- Uniprot:
- P36888
- Synonyme:
- CD135;CD135 antigen;fetal liver kinase 2;Fetal liver kinase-2;FL cytokine receptor;FLK-2;FLK2;fms related tyrosine kinase 3;fms-like tyrosine kinase 3;growth factor receptor tyrosine kinase type III;receptor-type tyrosine-protein kinase FLT3;stem cell tyrosine kinase 1;STK1
- Weitere Details:
- This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. This receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.
- Versandbedingungen:
- Blue Ice