CGB Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12419
Zusätzliche Namen:: CGB|CGB5|CGB7|CGB8|hCGB|LHB
Anwendung:: ELISA, WB
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Uniprot:: P0DN86
Synonyme:: CG-beta;CGB;CGB5;CGB7;CGB8;Choriogonadotropin subunit beta;choriogonadotropin subunit beta 3;chorionic gonadotrophin chain beta;chorionic gonadotropin beta 3 subunit;chorionic gonadotropin beta 5 subunit;chorionic gonadotropin beta 8 subunit;chorionic gonadotropin beta chain;chorionic gonadotropin beta subunit 3;chorionic gonadotropin beta subunit 5;chorionic gonadotropin beta subunit 8;chorionic gonadotropin chain beta;chorionic gonadotropin, beta polypeptide;chorionic gonadotropin, beta polypeptide 5;chorionic gonadotropin, beta polypeptide 8;HCG;hCGB;LHB;luteinizing hormone beta subunit
Weitere Details:: This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene.

Versandbedingungen:: Blue Ice