A12416
VE Cadherin Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12416
- Zusätzliche Namen:
- 7B4|CD144|VE Cadherin
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 140 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPREELLY
- Uniprot:
- P33151
- Synonyme:
- 7B4;7B4 antigen;cadherin 5, type 2 (vascular endothelium);cadherin 5, type 2, VE-cadherin (vascular epithelium);cadherin-5;CD144;cd144 antigen;endothelial-specific cadherin;vascular endothelial cadherin;VE-cadherin
- Weitere Details:
- This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer.
- Versandbedingungen:
- Blue Ice






