A12412
CD59 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12412
- Zusätzliche Namen:
- 16.3A5|1F5|CD59|EJ16|EJ30|EL32|G344|HRF-20|HRF20|MAC-IP|MACIF|MEM43|MIC11|MIN1|MIN2|MIN3|MIRL|MSK21|p18-20
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
- Uniprot:
- P13987
- Synonyme:
- 16.3A5;1F5;1F5 antigen;20 kDa homologous restriction factor;CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344);CD59 blood group antigen;CD59 glycoprotein;CD59 molecule, complement regulatory protein;EJ16;EJ30;EL32;G344;HRF-20;HRF20;human leukocyte antigen MIC11;Ly-6-like protein;lymphocytic antigen CD59/MEM43;MAC-inhibitory protein;MAC-IP;MACIF;MEM43;MEM43 antigen;membrane attack complex (MAC) inhibition factor;membrane attack complex inhibition factor;membrane inhibitor of reactive lysis;MIC11;MIN1;MIN2;MIN3;MIRL;MSK21;p18-20;protectin;surface anitgen recognized by monoclonal antibody 16.3A5;T cell-activating protein
- Weitere Details:
- This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.
- Versandbedingungen:
- Blue Ice

