A12410
[KO Validated] CD44 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A12410
- Zusätzliche Namen:
- 44|CDW44|CSPG8|ECM-III|ECMR-III|H-CAM|HCELL|Hermes-1|HUTCH-1|HUTCH-I|IN|LHR|MC56|MDU2|MDU3|MIC4|Pgp1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
- Uniprot:
- P16070
- Synonyme:
- CD44 antigen;CDW44;cell surface glycoprotein CD44;chondroitin sulfate proteoglycan 8;CSPG8;ECMR-III;epican;extracellular matrix receptor III;GP90 lymphocyte homing/adhesion receptor;HCELL;hematopoietic cell E- and L-selectin ligand;heparan sulfate proteoglycan;Hermes antigen;homing function and Indian blood group system;HUTCH-I;hyaluronate receptor;IN;Indian blood group antigen;LHR;MC56;MDU2;MDU3;MIC4;Pgp1;phagocytic glycoprotein 1;Phagocytic glycoprotein I;soluble CD44
- Weitere Details:
- The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.
- Versandbedingungen:
- Blue Ice
![[KO Validated] CD44 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12410/A12410_1.jpg)
![[KO Validated] CD44 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12410/A12410_2.jpg)
![[KO Validated] CD44 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12410/A12410_3.jpg)
![[KO Validated] CD44 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12410/A12410_4.jpg)
![[KO Validated] CD44 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12410/A12410_5.jpg)
![[KO Validated] CD44 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12410/A12410_N12599-4_WB_01.jpg)
![[KO Validated] CD44 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12410/A12410_N12599-4_KO-WB_01.jpg)
![[KO Validated] CD44 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12410/A12410_N12598-4_IHC_01.jpg)
![[KO Validated] CD44 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12410/A12410_N12598-4_IHC_02.jpg)