A1239
CGA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1239
- Zusätzliche Namen:
- CG-ALPHA|CGA|FSHA|GPA1|GPHa|GPHA1|HCG|LHA|TSHA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 13kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
- Uniprot:
- P01215
- Synonyme:
- anterior pituitary glycoprotein hormones common subunit alpha;CG-ALPHA;choriogonadotropin alpha chain;chorionic gonadotrophin subunit alpha;chorionic gonadotropin, alpha polypeptide;follicle-stimulating hormone alpha chain;follicle-stimulating hormone alpha subunit;follitropin alpha chain;FSH-alpha;FSHA;glycoprotein hormones alpha chain;GPA1;GPHa;GPHA1;HCG;LHA;LSH-alpha;luteinizing hormone alpha chain;lutropin alpha chain;thyroid-stimulating hormone alpha chain;thyrotropin alpha chain;TSH-alpha;TSHA
- Weitere Details:
- The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

