A12373
SLC25A19 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12373
- Zusätzliche Namen:
- DNC|MCPHA|MTPPT|MUP1|SLC25A19|THMD3|THMD4|TPC
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 36kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWK
- Uniprot:
- Q9HC21
- Synonyme:
- DNC;MCPHA;mitochondrial thiamine pyrophosphate carrier;mitochondrial uncoupling protein 1;MUP1;solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19;solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19;Solute carrier family 25 member 19;THMD3;THMD4;TPC
- Weitere Details:
- This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochondria, further studies have demonstrated that this protein instead functions as the mitochondrial thiamine pyrophosphate carrier, which transports thiamine pyrophosphates into mitochondria. Mutations in this gene cause microcephaly, Amish type, a metabolic disease that results in severe congenital microcephaly, severe 2-ketoglutaric aciduria, and death within the first year. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.
- Versandbedingungen:
- Blue Ice



