TNFSF13 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1237
Zusätzliche Namen:: APRIL|CD256|TALL-2|TALL2|TNFSF13|TNLG7B|TRDL-1|UNQ383/PRO715|ZTNF2
Anwendung:: ELISA, WB
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGL
Uniprot:: O75888
Synonyme:: a proliferation-inducing ligand;APRIL;CD256;TALL-2;TALL2;TNF- and APOL-related leukocyte expressed ligand 2;TNF-related death ligand 1;TNLG7B;TRDL-1;tumor necrosis factor (ligand) superfamily, member 13;tumor necrosis factor ligand 7B;tumor necrosis factor ligand superfamily member 13;tumor necrosis factor superfamily member 13;tumor necrosis factor-like protein ZTNF2;tumor necrosis factor-related death ligand-1;UNQ383/PRO715;ZTNF2
Weitere Details:: The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.

Versandbedingungen:: Blue Ice