SBF1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12354
Zusätzliche Namen:: CMT4B3|DENND7A|MTMR5|SBF1
Anwendung:: ELISA, WB
Molekulargewicht:: 208kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PPYDWELAQGPPEPPEEERSDGGAPQSRRRVVWPCYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTTSGSRQAAR
Uniprot:: O95248
Synonyme:: CMT4B3;DENN/MADD domain containing 7A;DENND7A;inactive phosphatidylinositol 3-phosphatase 5;MTMR5;myotubularin-related protein 5;SET-binding factor 1
Weitere Details:: This gene encodes a member of the protein-tyrosine phosphatase family. However, the encoded protein does not appear to be a catalytically active phosphatase because it lacks several amino acids in the catalytic pocket. This protein contains a Guanine nucleotide exchange factor (GEF) domain which is necessary for its role in growth and differentiation. Mutations in this gene have been associated with Charcot-Marie-Tooth disease 4B3. Pseudogenes of this gene have been defined on chromosomes 1 and 8.