ACSS2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A12334
Zusätzliche Namen:: ACAS2|ACECS|AceCS1|ACS|ACSA|ACSS2|dJ1161H23.1
Anwendung:: ELISA, WB
Molekulargewicht:: 79kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSN
Uniprot:: Q9NR19
Synonyme:: ACAS2;ACECS;AceCS1;acetate thiokinase;Acetate--CoA ligase;acetate-CoA ligase;Acetyl-CoA synthetase;acetyl-CoA synthetase 1;acetyl-Coenzyme A synthetase 2 (ADP forming);acetyl-coenzyme A synthetase, cytoplasmic;ACS;ACSA;acyl-activating enzyme;Acyl-CoA synthetase short-chain family member 2;cytoplasmic acetyl-coenzyme A synthetase;dJ1161H23.1;propionate--CoA ligase
Weitere Details:: This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants.