A1233
KLRC1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1233
- Zusätzliche Namen:
- CD159A|KLRC1|NKG2|NKG2A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
- Uniprot:
- P26715
- Synonyme:
- C-lectin type II protein;CD159 antigen-like family member A;CD159A;killer cell lectin-like receptor subfamily C, member 1;natural killer cell lectin;natural killer group protein 2;NK cell receptor A;NKG2;NKG2-1/B activating NK receptor;NKG2-A/B type II integral membrane protein;NKG2-A/B-activating NK receptor;NKG2-A/NKG2-B type II integral membrane protein;NKG2A
- Weitere Details:
- Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
- Versandbedingungen:
- Blue Ice

