Glycophorin C (GYPC) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1232
Zusätzliche Namen:: CD236|CD236R|GE|Glycophorin C (GYPC)|GPC|GPD|GYPD|PAS-2|PAS-2'
Anwendung:: ELISA, WB
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Uniprot:: P04921
Synonyme:: CD236;CD236R;GE;Gerbich blood group antigen;glycoconnectin;glycophorin-C;glycophorin-D;glycoprotein beta;GPC;GPD;GYPD;PAS-2;PAS-2';sialoglycoprotein D
Weitere Details:: Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. Alternate splicing results in multiple transcript variants.