A12319
MAP1LC3A Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A12319
- Zusätzliche Namen:
- ATG8E|LC3|LC3A|MAP1ALC3|MAP1BLC3|MAP1LC3A
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 14kDa,16kDa/16kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
- Uniprot:
- Q9H492
- Synonyme:
- ATG8E;Autophagy-related protein LC3 A;autophagy-related ubiquitin-like modifier LC3 A;LC3;LC3A;MAP1 light chain 3-like protein 1;MAP1A/1B light chain 3 A;MAP1A/MAP1B LC3 A;MAP1A/MAP1B light chain 3 A;MAP1ALC3;MAP1BLC3;Microtubule-associated protein 1 light chain 3 alpha;microtubule-associated proteins 1A/1B light chain 3;microtubule-associated proteins 1A/1B light chain 3A
- Weitere Details:
- MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis.
- Versandbedingungen:
- Blue Ice





