AMPKA Alpha1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1229
Zusätzliche Namen:: AMPK|AMPK alpha 1|AMPKa1|AMPKA Alpha1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 64kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVS
Uniprot:: Q13131
Synonyme:: 5'-AMP-activated protein kinase catalytic subunit alpha-1;5'-AMP-activated protein kinase, catalytic alpha-1 chain;ACACA kinase;acetyl-CoA carboxylase kinase;AMP -activate kinase alpha 1 subunit;AMP-activated protein kinase, catalytic, alpha-1;AMPK;AMPK alpha 1;AMPK subunit alpha-1;AMPK, alpha, 1;AMPKa1;HMGCR kinase;hydroxymethylglutaryl-CoA reductase kinase;protein kinase, AMP-activated, alpha 1 catalytic subunit;tau-protein kinase PRKAA1
Weitere Details:: The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Versandbedingungen:: Blue Ice