DPYSL3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12280
Zusätzliche Namen:: CRMP-4|CRMP4|DPYSL3|DRP-3|DRP3|LCRMP|ULIP|ULIP-1
Anwendung:: ELISA, WB
Molekulargewicht:: 62kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSAR
Uniprot:: Q14195
Synonyme:: Collapsin response mediator protein 4;collapsin response mediator protein 4 long;CRMP-4;CRMP4;dihydropyrimidinase-related protein 3;DRP-3;DRP3;LCRMP;testicular secretory protein Li 7;ULIP;ULIP-1;unc-33-like phosphoprotein 1
Weitere Details:: Enables filamin binding activity. Predicted to be involved in several processes, including actin filament organization; regulation of plasma membrane bounded cell projection organization; and response to axon injury. Predicted to act upstream of or within nervous system development. Predicted to be located in several cellular components, including cell body; growth cone; and lamellipodium. Predicted to be part of filamentous actin. Predicted to be active in synapse. Predicted to colocalize with exocytic vesicle.