A12239
RRBP1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12239
- Zusätzliche Namen:
- ES/130|ES130|hES|p180|RRBP1|RRp
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 120kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKKKKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAPVATVPAMPQEKLASSPKDKK
- Uniprot:
- Q9P2E9
- Synonyme:
- 180 kDa ribosome receptor homolog;endoplasmic reticulum ribosome-binding protein 1;ES/130;ES/130-related protein;ES130;hES;p180;ribosomal receptor-binding protein 1;ribosome binding protein 1 homolog 180kDa (dog);ribosome receptor protein;ribosome-binding protein 1;RRp
- Weitere Details:
- This gene encodes a ribosome-binding protein of the endoplasmic reticulum (ER) membrane. Studies suggest that this gene plays a role in ER proliferation, secretory pathways and secretory cell differentiation, and mediation of ER-microtubule interactions. Alternative splicing has been observed and protein isoforms are characterized by regions of N-terminal decapeptide and C-terminal heptad repeats. Splicing of the tandem repeats results in variations in ribosome-binding affinity and secretory function. The full-length nature of variants which differ in repeat length has not been determined. Pseudogenes of this gene have been identified on chromosomes 3 and 7, and RRBP1 has been excluded as a candidate gene in the cause of Alagille syndrome, the result of a mutation in a nearby gene on chromosome 20p12.
- Versandbedingungen:
- Blue Ice



