A12191
SSPN Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12191
- Zusätzliche Namen:
- DAGA5|KRAG|NSPN|SPN1|SPN2|SSPN
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQ
- Uniprot:
- Q14714
- Synonyme:
- DAGA5;K-ras oncogene-associated protein;kirsten-ras-associated protein;KRAG;Kras oncogene-associated;microspan;nanospan;NSPN;sarcospan;sarcospan (Kras oncogene-associated gene);SPN1;SPN2
- Weitere Details:
- This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described.
- Versandbedingungen:
- Blue Ice