PMEPA1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12171
Zusätzliche Namen:: PMEPA1|STAG1|TMEPAI
Anwendung:: ELISA, WB
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Uniprot:: Q969W9
Synonyme:: Prostate transmembrane protein androgen induced 1;protein TMEPAI;solid tumor-associated 1 protein;STAG1;TMEPAI;Transmembrane prostate androgen-induced protein;transmembrane, prostate androgen induced RNA
Weitere Details:: This gene encodes a transmembrane protein that contains a Smad interacting motif (SIM). Expression of this gene is induced by androgens and transforming growth factor beta, and the encoded protein suppresses the androgen receptor and transforming growth factor beta signaling pathways though interactions with Smad proteins. Overexpression of this gene may play a role in multiple types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.