A12151
EP400 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12151
- Zusätzliche Namen:
- CAGH32|EP400|P400|TNRC12
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 400kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGVLLPGAGGAAGFGMTSPPPPTSPSRTAVPPG
- Uniprot:
- Q96L91
- Synonyme:
- CAG repeat protein 32;CAGH32;domino homolog;E1A-binding protein p400;hDomino;hDomino(p400);P400;p400 kDa SWI2/SNF2-related protein;p400 SWI2/SNF2-related protein;TNRC12;trinucleotide repeat containing 12;trinucleotide repeat-containing gene 12 protein
- Weitere Details:
- Predicted to enable several functions, including ATP binding activity; ATP-dependent chromatin remodeler activity; and protein antigen binding activity. Involved in histone H2A acetylation and histone H4 acetylation. Part of NuA4 histone acetyltransferase complex and Swr1 complex.
- Versandbedingungen:
- Blue Ice