A1215
[KO Validated] SHMT2 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A1215
- Zusätzliche Namen:
- GLYA|HEL-S-51e|mSHMT|NEDCASB|SHMT|T2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 56kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH
- Uniprot:
- P34897
- Synonyme:
- epididymis secretory sperm binding protein Li 51e;GLY A+;GLYA;glycine auxotroph A, human complement for hamster;glycine hydroxymethyltransferase;HEL-S-51e;NEDCASB;serine aldolase;serine hydroxymethylase;serine hydroxymethyltransferase 2 (mitochondrial);serine hydroxymethyltransferase, mitochondrial;serine methylase;SHMT;threonine aldolase
- Weitere Details:
- This gene encodes the mitochondrial form of a pyridoxal phosphate-dependent enzyme that catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. The encoded product is primarily responsible for glycine synthesis. The activity of the encoded protein has been suggested to be the primary source of intracellular glycine. The gene which encodes the cytosolic form of this enzyme is located on chromosome 17. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice
![[KO Validated] SHMT2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1215/A1215_1.jpg)
![[KO Validated] SHMT2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1215/A1215_2.jpg)
![[KO Validated] SHMT2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1215/A1215_3.jpg)
![[KO Validated] SHMT2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1215/A1215_N2854-4_WB_01.jpg)
![[KO Validated] SHMT2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1215/A1215_N19565-4_WB_01.jpg)
![[KO Validated] SHMT2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1215/A1215_N19565-4_WB_02.jpg)