A1214
[KO Validated] RhoGDI Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A1214
- Zusätzliche Namen:
- DI|GDIA1|HEL-S-47e|NPHS8|RHOGDI|RHOGDI-1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 25kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
- Uniprot:
- P52565
- Synonyme:
- epididymis secretory sperm binding protein Li 47e;GDIA1;GDP-dissociation inhibitor, aplysia RAS-related 1;HEL-S-47e;NPHS8;Rho GDP dissociation inhibitor (GDI) alpha;rho GDP-dissociation inhibitor 1;Rho-GDI alpha;RHOGDI;RHOGDI-1
- Weitere Details:
- This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice
![[KO Validated] RhoGDI Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1214/A1214_1.jpg)
![[KO Validated] RhoGDI Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1214/A1214_2.jpg)
![[KO Validated] RhoGDI Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1214/A1214_H304_KO-WB_01.jpg)
![[KO Validated] RhoGDI Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1214/A1214_H348_IF_01.jpg)