NLRP11 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12132
Zusätzliche Namen:: CLR19.6|NALP11|NLRP11|NOD17|PAN10|PYPAF6|PYPAF7
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VGFTEADVSVLQAANILLPSNTHKDRYKFIHLNVQEFCTAIAFLMAVPNYLIPSGSREYKEKREQYSDFNQVFTFIFGLLNANRRKILETSFGYQLPMVDSFKWYSVGYMKHLDRDPEKLTHHMPLFYCLYENREEEFVKTIVDALMEVTVYLQSDKDMMVSLYCLDYCCHLRTLKLSVQR
Uniprot:: P59045
Synonyme:: CLR19.6;NACHT, leucine rich repeat and PYD containing 11;NACHT, LRR and PYD domains-containing protein 11;NALP11;NOD17;nucleotide-binding oligomerization domain protein 17;nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 11;PAAD- and NACHT-containing protein 10B;PAAD-and NACHT domain-containing protein 10;PAN10;PYPAF6;PYPAF7;PYRIN-containing APAF1-like protein 6
Weitere Details:: This gene is a member of the the NOD-like receptor protein (NLRP) gene family and encodes a protein with an N-terminal pyrin death (PYD) domain and nucleoside triphosphate hydrolase (NACHT) domain and a C-terminal leucine-rich repeats (LRR) region. This gene has been shown to regulate caspases in the proinflammatory signal transduction pathway and, based on studies of other members of the NLRP gene family with similar domain structure, is predicted to form part of the multiprotein inflammasome complex. Alternative splicing produces multiple transcript variants encoding distince isoforms.

Versandbedingungen:: Blue Ice