ACAP2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12127
Zusätzliche Namen:: ACAP2|CENTB2|CNT-B2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 115kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILT
Uniprot:: Q15057
Synonyme:: Arf GAP with coiled coil, ANK repeat and PH domains 2;arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2;centaurin-beta-2;CENTB2;CNT-B2
Weitere Details:: Enables GTPase activator activity. Acts upstream of or within actin filament-based process. Located in ruffle.