SART3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12124
Zusätzliche Namen:: DSAP1|P100|p110|p110(nrb)|RP11-13G14|SART3|TIP110
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK
Uniprot:: Q15020
Synonyme:: DSAP1;HIV-1 Tat-interacting protein of 110kDa;hSART-3;P100;p110;p110 nuclear RNA-binding protein;p110(nrb);PRP24 homolog;RP11-13G14;SART-3;squamous cell carcinoma antigen recognized by T cells 3;squamous cell carcinoma antigen recognized by T-cells 3;tat-interacting protein of 110 kDa;TIP110
Weitere Details:: The protein encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing.

Versandbedingungen:: Blue Ice