NDUFA8 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12118
Zusätzliche Namen:: CI-19KD|CI-PGIV|MC1DN37|NDUFA8|PGIV
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Uniprot:: P51970
Synonyme:: CI-19KD;CI-PGIV;complex I-19kD;complex I-PGIV;MC1DN37;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8;NADH-ubiquinone oxidoreductase 19 kDa subunit;NADH:ubiquinone oxidoreductase PGIV subunit;PGIV
Weitere Details:: The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.