SMARCD2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12104
Zusätzliche Namen:: BAF60B|CRACD2|PRO2451|Rsc6p|SGD2|SMARCD2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
Uniprot:: Q92925
Synonyme:: 60 kDa BRG-1/Brm-associated factor subunit B;BAF60B;BRG1-associated factor 60B;chromatin remodeling complex BAF60B subunit;CRACD2;mammalian chromatin remodeling complex BRG1-associated factor 60B;PRO2451;Rsc6p;SGD2;SWI/SNF complex 60 kDa subunit B;SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2;Swp73-like protein
Weitere Details:: The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.