RanBP9 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12097
Zusätzliche Namen:: BPM-L|BPM90|RanBP7|RanBP9|RANBPM
Anwendung:: ELISA, WB
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQL
Uniprot:: Q96S59
Synonyme:: BPM-L;BPM90;novel centrosomal protein RanBPM;Ran Binding Protein in the Microtubule organizing center;ran binding protein, centrosomal;ran-binding protein 9;ran-binding protein M;RanBP7;RANBPM
Weitere Details:: This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11.