PKLR Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12084
Zusätzliche Namen:: PK1|PKL|PKLR|PKRL|RPK
Anwendung:: ELISA, WB
Molekulargewicht:: 62kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT
Uniprot:: P30613
Synonyme:: PK1;PKL;PKRL;pyruvate kinase 1;pyruvate kinase isozyme R/L;pyruvate kinase isozymes L/R;pyruvate kinase isozymes R/L;pyruvate kinase PKLR;pyruvate kinase type L;pyruvate kinase, liver and blood cell;pyruvate kinase, liver and RBC;R-type/L-type pyruvate kinase;red cell/liver pyruvate kinase;RPK
Weitere Details:: The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.