SPON2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12077
Zusätzliche Namen:: DIL-1|DIL1|M-SPONDIN|MINDIN|SPON2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVS
Uniprot:: Q9BUD6
Synonyme:: differentially expressed in cancerous and non-cancerous lung cells 1;DIL-1;DIL1;M-SPONDIN;MINDIN;spondin 2, extracellular matrix protein;spondin-2
Weitere Details:: Predicted to enable antigen binding activity; lipopolysaccharide binding activity; and metal ion binding activity. Predicted to be involved in cell adhesion. Predicted to act upstream of or within several processes, including defense response to other organism; opsonization; and positive regulation of cytokine production. Located in extracellular exosome.