MEF2A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12059
Zusätzliche Namen:: ADCAD1|mef2|MEF2A|RSRFC4|RSRFC9
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGRKKIQITRIMDERNRQTLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNEDSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA
Uniprot:: Q02078
Synonyme:: ADCAD1;MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancer factor 2A);mef2;myocyte-specific enhancer factor 2A;RSRFC4;RSRFC9;serum response factor-like protein 1
Weitere Details:: The protein encoded by this gene is a DNA-binding transcription factor that activates many muscle-specific, growth factor-induced, and stress-induced genes. The encoded protein can act as a homodimer or as a heterodimer and is involved in several cellular processes, including muscle development, neuronal differentiation, cell growth control, and apoptosis. Defects in this gene could be a cause of autosomal dominant coronary artery disease 1 with myocardial infarction (ADCAD1). Several transcript variants encoding different isoforms have been found for this gene.