A12047
GABPA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12047
- Zusätzliche Namen:
- E4TF1-60|E4TF1A|GABPA|NFT2|NRF2|NRF2A|RCH04A07
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK
- Uniprot:
- Q06546
- Synonyme:
- E4TF1-60;E4TF1A;GA binding protein transcription factor alpha subunit 60kDa;GA-binding protein alpha chain;GABP subunit alpha;human nuclear respiratory factor-2 subunit alpha;NFT2;NRF2;NRF2A;nuclear respiratory factor 2 alpha subunit;nuclear respiratory factor 2 subunit alpha;RCH04A07;transcription factor E4TF1-60
- Weitere Details:
- This gene encodes one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. This subunit also shares identity with a subunit constituting the transcription factor E4TF1, responsible for expression of the adenovirus E4 gene. Because of its chromosomal localization and ability to form heterodimers with other polypeptides, this gene may play a role in the Down Syndrome phenotype. Two transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice

