A12029
MYH10 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12029
- Zusätzliche Namen:
- MYH10|NMMHC-IIB|NMMHCB
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 250kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE
- Uniprot:
- P35580
- Synonyme:
- Cellular myosin heavy chain, type B;Myosin heavy chain 10;Myosin heavy chain, non-muscle IIb;myosin heavy chain, nonmuscle type B;myosin-10;myosin, heavy chain 10, non-muscle;myosin, heavy polypeptide 10, non-muscle;NMMHC-IIB;NMMHCB;Non-muscle myosin heavy chain B;Non-muscle myosin heavy chain IIb;nonmuscle myosin heavy chain IIB;nonmuscle myosin II heavy chain-B
- Weitere Details:
- This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice