CAPN3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11995
Zusätzliche Namen:: CANP3|CANPL3|CAPN3|LGMD2|LGMD2A|LGMDD4|LGMDR1|nCL-1|p94
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 114kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIA
Uniprot:: P20807
Synonyme:: Calcium-activated neutral proteinase 3;Calpain L3;Calpain p94;calpain p94, large [catalytic] subunit;calpain-3;calpain, large polypeptide L3;CANP3;CANPL3;LGMD2;LGMD2A;LGMDD4;LGMDR1;Muscle-specific calcium-activated neutral protease 3;muscle-specific calcium-activated neutral protease 3 large subunit;nCL-1;new calpain 1;p94
Weitere Details:: Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed.

Versandbedingungen:: Blue Ice