A11976
SLC5A1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A11976
- Zusätzliche Namen:
- D22S675|NAGT|SGLT-1|SGLT1|SLC5A1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 74kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA
- Uniprot:
- P13866
- Synonyme:
- D22S675;high affinity sodium-glucose cotransporter;Na+/glucose cotransporter 1;NAGT;SGLT1;sodium/glucose cotransporter 1;solute carrier family 5 (sodium/glucose cotransporter), member 1;Solute carrier family 5 member 1
- Weitere Details:
- This gene encodes a member of the sodium-dependent glucose transporter (SGLT) family. The encoded integral membrane protein is the primary mediator of dietary glucose and galactose uptake from the intestinal lumen. Mutations in this gene have been associated with glucose-galactose malabsorption. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice