A1195
PDGFB Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1195
- Zusätzliche Namen:
- c-sis|IBGC5|PDGF-2|PDGF2|PDGFB|SIS|SSV
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 27 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
- Uniprot:
- P01127
- Synonyme:
- becaplermin;c-sis;epididymis secretory sperm binding protein;IBGC5;PDGF subunit B;PDGF-2;PDGF, B chain;PDGF2;platelet-derived growth factor 2;platelet-derived growth factor B chain;Platelet-derived growth factor beta polypeptide;platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog);platelet-derived growth factor subunit B;platelet-derived growth factor, beta polypeptide (oncogene SIS);proto-oncogene c-Sis;SIS;SSV
- Weitere Details:
- This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice