A11948
SAA3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A11948
- Zusätzliche Namen:
- l7R3|Saa-3|SAA3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
- Synonyme:
- AV098916;l7;l7R3;Sa;Saa-3;SAA3;serum amyloid A-3 protein
- Weitere Details:
- Enables Toll-like receptor 4 binding activity and chemoattractant activity. Acts upstream of or within several processes, including I-kappaB phosphorylation; cellular response to interleukin-1; and response to stilbenoid. Located in extracellular space. Is expressed in cerebellum; ileum; liver; reproductive system; and thymus. Orthologous to several human genes including SAA2 (serum amyloid A2).
- Versandbedingungen:
- Blue Ice